PDB entry 1lmj

View 1lmj on RCSB PDB site
Description: nmr study of the fibrillin-1 cbegf12-13 pair of ca2+ binding epidermal growth factor-like domains
Deposited on 2002-05-02, released 2003-04-29
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-29, with a file datestamp of 2003-04-29.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1lmja1, d1lmja2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmjA (A:)
  tdidecrispdlcgrgqcvntpgdfeckcdegyesgfmmmkncmdidecqrdpllcrggv
  chntegsyrcecppghqlspnisaci