PDB entry 1lmj

View 1lmj on RCSB PDB site
Description: NMR Study of the Fibrillin-1 cbEGF12-13 Pair of Ca2+ Binding Epidermal Growth Factor-like Domains
Class: structural protein
Keywords: EGF, calcium, microfibril, neonatal, Marfan syndrome, connective tissue, extracellular matrix, STRUCTURAL PROTEIN
Deposited on 2002-05-02, released 2003-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FBN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lmja1, d1lmja2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmjA (A:)
    tdidecrispdlcgrgqcvntpgdfeckcdegyesgfmmmkncmdidecqrdpllcrggv
    chntegsyrcecppghqlspnisaci