PDB entry 1lmc

View 1lmc on RCSB PDB site
Description: the crystal structure of a complex between bulgecin, a bacterial metabolite, and lysozyme from the rainbow trout
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-11-14, released 1996-01-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Oncorhynchus mykiss [TaxId:8022]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11941 (0-128)
    • conflict (85)
  Domains in SCOPe 2.03: d1lmca_
• Heterogens: BUL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lmcA (A:)
  kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
  rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
  rsyvagcgv