PDB entry 1llo

View 1llo on RCSB PDB site
Description: hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin
Deposited on 1995-11-08, released 1996-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.146
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1llo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llo_ (-)
    ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
    sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
    gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
    qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
    peikkspkyggvmlwskfyddkngysssildsv