PDB entry 1llc

View 1llc on RCSB PDB site
Description: structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution
Class: oxidoreductase(choh(d)-nad(a))
Keywords: oxidoreductase(choh(d)-nad(a))
Deposited on 1988-11-21, released 1989-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.374
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei [TaxId:1582]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00343 (0-End)
      • conflict (24)
      • conflict (86-87)
      • conflict (117)
      • conflict (268)
      • conflict (271)
    Domains in SCOPe 2.06: d1llca1, d1llca2
  • Heterogens: AFP, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1llcA (A:)
    asitdkdhqkvilvgdgavgssyafamvlqgiaqeigivdifkdktkgdaidlsnalpft
    spkkiysaeysdakdadlvvitagapkqpgetrldlvnknlkilksivdpivdsgfnlif
    lvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgeh
    gdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiat
    alariskailndenavlplsvymdgqygindlyigtpavinrngiqnileipltdheees
    mqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1llcA (A:)
    asitdkdhqkvilvgdgavgssyafamvlqgiaqeigivdifkdktkgdaidlsnalpft
    spkkiysaeysdakdadlvvitagapkqpgetrldlvnknlkilksivdpivdsgfnlif
    lvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgeh
    gdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiat
    alariskailndenavlplsvymdgqygindlyigtpavinrngiqnileipltdheees
    mqksasqlkkvltdafakndi