PDB entry 1lla

View 1lla on RCSB PDB site
Description: crystal structure of deoxygenated limulus polyphemus subunit II hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1992-09-07, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemocyanin (subunit type II)
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04253 (Start-627)
      • conflict (8)
      • conflict (407-408)
    Domains in SCOPe 2.06: d1llaa1, d1llaa2, d1llaa3
  • Heterogens: CU, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1llaA (A:)
    tlhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl
    yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfi
    psaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvginahhwhwhlvy
    pstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphl
    thvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhg
    tdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpif
    ynwhrfidnifheykntlkpydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhg
    inpgnarsikaryyhldhepfsyavnvqnnsasdkhatvriflapkydelgneikadelr
    rtaieldkfktdlhpgkntvvrhsldssvtlshqptfedllhgvglnehkseycscgwps
    hllvpkgnikgmeyhlfvmltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpf
    drpihtehisdfltnnmfikdikikfhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1llaA (A:)
    lhdkqirichlfeqlssathsdrlknvgklqpgaifscfhpdhleearhlyevfweagdf
    ndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfipsaaineafk
    kespilvdvtgnildpeyrlayyredvginahhwhwhlvypstwnpkyfgkkkdrkgelf
    yymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphlthvasgkyysprpdglklrd
    lgdieisemvrmrerildsihlgyvisedgshktldelhgtdilgalvessyesvnheyy
    gnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpifynwhrfidnifheykntlkp
    ydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhep
    fsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgkntv
    vrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdwd
    kdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe