PDB entry 1ll6

View 1ll6 on RCSB PDB site
Description: structure of the d169n mutant of c. immitis chitinase 1
Class: hydrolase
Keywords: beta-alpha barrel, hydrolase
Deposited on 2002-04-26, released 2002-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.182
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54196 (0-391)
      • engineered (133)
    Domains in SCOPe 2.06: d1ll6a1, d1ll6a2
  • Chain 'B':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54196 (0-391)
      • engineered (133)
    Domains in SCOPe 2.06: d1ll6b1, d1ll6b2
  • Chain 'C':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54196 (0-391)
      • engineered (133)
    Domains in SCOPe 2.06: d1ll6c1, d1ll6c2
  • Chain 'D':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54196 (0-391)
      • engineered (133)
    Domains in SCOPe 2.06: d1ll6d1, d1ll6d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll6A (A:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgidinweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll6B (B:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgidinweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll6C (C:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgidinweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll6D (D:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgidinweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps