PDB entry 1ll4

View 1ll4 on RCSB PDB site
Description: structure of c. immitis chitinase 1 complexed with allosamidin
Class: hydrolase
Keywords: beta-alpha barrel, enzyme-inhibitor complex, hydrolase
Deposited on 2002-04-26, released 2002-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • PIR JC4565 (0-391)
    Domains in SCOPe 2.06: d1ll4a1, d1ll4a2
  • Chain 'B':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • PIR JC4565 (0-391)
    Domains in SCOPe 2.06: d1ll4b1, d1ll4b2
  • Chain 'C':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • PIR JC4565 (0-391)
    Domains in SCOPe 2.06: d1ll4c1, d1ll4c2
  • Chain 'D':
    Compound: chitinase 1
    Species: Coccidioides immitis [TaxId:5501]
    Gene: CTS1
    Database cross-references and differences (RAF-indexed):
    • PIR JC4565 (0-391)
    Domains in SCOPe 2.06: d1ll4d1, d1ll4d2
  • Heterogens: AMI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll4A (A:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll4B (B:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll4C (C:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll4D (D:)
    ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
    dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
    klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
    pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
    yikagvpankivlgmplygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtel
    ediaasysydknkrylisydtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvv
    nglggtgkleqrenelsypesvydnlkngmps