PDB entry 1ll1

View 1ll1 on RCSB PDB site
Description: hydroxo bridge met form hemocyanin from limulus
Class: oxygen transport
Keywords: oxygen transport, respiratory protein, glycoprotein
Deposited on 1997-03-17, released 1997-08-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.167
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metcyanin II
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ll1a1, d1ll1a2, d1ll1a3
  • Heterogens: CU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ll1A (A:)
    tlhdkqirvchlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl
    yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfi
    psaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvginahhwhwhlvy
    pstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphl
    thvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhg
    tdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpif
    ynwhrfidnifheykntlkpydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhg
    inpgnarsikaryyhldhepfsyavnvqnnsasdkhatvriflapkydelgneikadelr
    rtaieldkfktdlhpgkntvvrhsldssvtlshqptfedllhgvglnehkseycscgwps
    hllvpkgnikgmeyhlfvmltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpf
    drpihtehisdfltnnmfikdikikfhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ll1A (A:)
    tlhdkqirvchlfeqlssatvirlknvgklqpgaifscfhpdhleearhlyevfweagdf
    ndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfipsaaineafk
    kilvdvgnildpeyrlayyredvginahhwhwhlvypstwnpkyfgkkkdrkgelfyymh
    qqmcarydcerlsngmhrmlpfnnfdeplagyaphlthvasgkyysprpdglklrdlgdi
    eisemvrmrerildsihlgyvisedgshktldelhgtdilgalvessyesvnheyygnlh
    nwghvtmarihdpdgrfheepgvmsdtstslrdpifynwhrfidnifheykntlkpydhd
    vlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhepfsya
    vnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgkntvvrhs
    ldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkvvacvd
    avsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe