PDB entry 1ll1

View 1ll1 on RCSB PDB site
Description: hydroxo bridge met form hemocyanin from limulus
Deposited on 1997-03-17, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.167
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ll1_ (-)
    tlhdkqirvchlfeqlssatvirlknvgklqpgaifscfhpdhleearhlyevfweagdf
    ndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfipsaaineafk
    kilvdvgnildpeyrlayyredvginahhwhwhlvypstwnpkyfgkkkdrkgelfyymh
    qqmcarydcerlsngmhrmlpfnnfdeplagyaphlthvasgkyysprpdglklrdlgdi
    eisemvrmrerildsihlgyvisedgshktldelhgtdilgalvessyesvnheyygnlh
    nwghvtmarihdpdgrfheepgvmsdtstslrdpifynwhrfidnifheykntlkpydhd
    vlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhepfsya
    vnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgkntvvrhs
    ldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkvvacvd
    avsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe