PDB entry 1lkz

View 1lkz on RCSB PDB site
Description: Crystal structure of D-ribose-5-phosphate isomerase (RpiA) from Escherichia coli.
Class: isomerase
Keywords: ribose phosphate isomerase, RpiA, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, ISOMERASE
Deposited on 2002-04-26, released 2002-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose 5-phosphate isomerase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z0 (0-218)
      • modified residue (0)
      • modified residue (41)
      • modified residue (89)
      • modified residue (91)
      • modified residue (137)
      • modified residue (173)
      • modified residue (181)
    Domains in SCOPe 2.07: d1lkza1, d1lkza2
  • Chain 'B':
    Compound: Ribose 5-phosphate isomerase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z0 (0-218)
      • modified residue (0)
      • modified residue (41)
      • modified residue (89)
      • modified residue (91)
      • modified residue (137)
      • modified residue (173)
      • modified residue (181)
    Domains in SCOPe 2.07: d1lkzb1, d1lkzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkzA (A:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkzB (B:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk