PDB entry 1lkp

View 1lkp on RCSB PDB site
Description: Crystal structure of Desulfovibrio vulgaris rubrerythrin all-iron(II) form, azide adduct
Deposited on 2002-04-25, released 2002-09-18
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-18, with a file datestamp of 2002-09-18.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lkpA (A:)
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
ahfellginw