PDB entry 1lkn

View 1lkn on RCSB PDB site
Description: Solution NMR Structure of Protein TM_1112 from Thermotoga maritima. Ontario Centre for Structural Proteomics Target TM1112_1_89; Northeast Structural Genomics Consortium Target VT74.
Class: structural genomics, unknown function
Keywords: BETA BARREL, structural genomics, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, PSI, Northeast Structural Genomics Consortium, unknown function
Deposited on 2002-04-25, released 2003-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein tm1112
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1112
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lkna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lknA (A:)
mevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvi
ekgdlvtfpkglrcrwkvlepvrkhynlf