PDB entry 1lk2

View 1lk2 on RCSB PDB site
Description: 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
Class: immune system
Keywords: Class I MHC-peptide complex, high resolution, anisotropic and TLS refinement
Deposited on 2002-04-23, released 2003-11-11
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.15
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lk2a1, d1lk2a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lk2b_
  • Chain 'P':
    Compound: insulin receptor, beta-subunit
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, PO4, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lk2A (A:)
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
fqkwasvvvplgkeqyytchvyhqglpepltlrw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lk2B (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'P':
    No sequence available.