PDB entry 1ljy

View 1ljy on RCSB PDB site
Description: Crystal Structure of a Novel Regulatory 40 kDa Mammary Gland Protein (MGP-40) secreted during Involution
Class: signaling protein
Keywords: Mammary Gland protein, Marker protein, Cancer regressor protein, Signaling Protein
Deposited on 2002-04-23, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mgp-40
    Species: Capra hircus [TaxId:9925]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAL87007 (0-359)
      • conflict (32)
      • conflict (86)
      • conflict (130)
      • conflict (204-205)
      • conflict (207)
      • conflict (251)
    Domains in SCOPe 2.07: d1ljya1, d1ljya2
  • Heterogens: NAG, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ljyA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdggapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    v