PDB entry 1ljr

View 1ljr on RCSB PDB site
Description: glutathione transferase (hgst t2-2) from human
Deposited on 1998-03-08, released 1999-03-23
The last revision prior to the SCOP 1.61 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.208
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ljrA (A:)
    mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
    dfiltessailiylsckyqtpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlg
    pligvqvpeekvernrtamdqalqwledkflgdrpflagqqvtladlmaleelmqpvalg
    yelfegrprlaawrgrveaflgaelcqeahsiilsileqaakktlptpspeayqamllri
    arip
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ljrB (B:)
    mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
    dfiltessailiylsckyqtpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlg
    pligvqvpeekvernrtamdqalqwledkflgdrpflagqqvtladlmaleelmqpvalg
    yelfegrprlaawrgrveaflgaelcqeahsiilsileqaakktlptpspeayqamllri
    arip