PDB entry 1lj8

View 1lj8 on RCSB PDB site
Description: Crystal structure of mannitol dehydrogenase in complex with NAD
Deposited on 2002-04-19, released 2002-11-15
The last revision prior to the SCOP 1.65 freeze date was dated 2002-11-15, with a file datestamp of 2002-11-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.171
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lj8A (A:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lj8A (A:)
    mklnkqnltqlapevklpaytladtrqgiahigvggfhrahqayytdalmntgegldwsi
    cgvglrsedrkarddlagqdylftlyelgdtddtevrvigsisdmllaedsaqalidkla
    speirivsltiteggyciddsngefmahlpqiqhdlahpsspktvfgficaaltqrraag
    ipaftvmscdnlphngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstah
    rlqlhdehgiddawpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkiglln
    gshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvd
    rfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvden
    gvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdng
    vtttlkhllkkp