PDB entry 1liz

View 1liz on RCSB PDB site
Description: Solution structure of the heme chaperone CcmE of Escherichia coli
Deposited on 2002-04-18, released 2002-12-11
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1liza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lizA (A:)
    lrsnidlfytpgeilygkretqqmpevgqrlrvggmvmpgsvqrdpnslkvtftiydaeg
    svdvsyegilpdlfregqgvvvqgelekgnhilakevlakhdenytppevekameanhrr
    pasvykdpashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lizA (A:)
    lrsnidlfytpgeilygkretqqmpevgqrlrvggmvmpgsvqrdpnslkvtftiydaeg
    svdvsyegilpdlfregqgvvvqgelekgnhilakevlakhdenytppevekam