PDB entry 1liz

View 1liz on RCSB PDB site
Description: Solution structure of the heme chaperone CcmE of Escherichia coli
Deposited on 2002-04-18, released 2002-12-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1liza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lizA (A:)
  lrsnidlfytpgeilygkretqqmpevgqrlrvggmvmpgsvqrdpnslkvtftiydaeg
  svdvsyegilpdlfregqgvvvqgelekgnhilakevlakhdenytppevekam