PDB entry 1lil

View 1lil on RCSB PDB site
Description: bence jones protein cle, a lambda iii immunoglobulin light-chain dimer
Deposited on 1996-05-13, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.2
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lilA (A:)
    yevtqppslsvspgqtaritcsgeklgdayvcwyqqrpgqspvvviyqdnrrpsgiperf
    sgsssgntatltisgtqtldeadyycqvwdsnasvvfgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lilB (B:)
    yevtqppslsvspgqtaritcsgeklgdayvcwyqqrpgqspvvviyqdnrrpsgiperf
    sgsssgntatltisgtqtldeadyycqvwdsnasvvfgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs