PDB entry 1lia

View 1lia on RCSB PDB site
Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution
Class: light harvesting protein
Keywords: light harvesting protein
Deposited on 1996-01-29, released 1997-07-29
The last revision prior to the SCOP 1.75 freeze date was dated 1997-07-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.18
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: r-phycoerythrin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01921 (0-163)
      • conflict (65)
    Domains in SCOP 1.75: d1liaa_
  • Chain 'B':
    Compound: r-phycoerythrin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1liab_
  • Chain 'K':
    Compound: r-phycoerythrin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01921 (0-163)
      • conflict (65)
    Domains in SCOP 1.75: d1liak_
  • Chain 'L':
    Compound: r-phycoerythrin
    Species: Polysiphonia urceolata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lial_
  • Heterogens: CYC, PUB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1liaA (A:)
    mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
    skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
    nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1liaB (B:)
    mldafsrvvvnsdskaayvsgsdlqalktfindgnkrldavnyivsnsscivsdaisgmi
    cenpglitpggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
    gvptnstvravsimkaaavcfisntasqrkveviegdcsalasevasycdrvvaavs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1liaK (K:)
    mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
    skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
    nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1liaL (L:)
    mldafsrvvvnsdskaayvsgsdlqalktfindgnkrldavnyivsnsscivsdaisgmi
    cenpglitpggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
    gvptnstvravsimkaaavcfisntasqrkveviegdcsalasevasycdrvvaavs