PDB entry 1li9

View 1li9 on RCSB PDB site
Description: Crystal structure of TEM-34 beta-Lactamase at 1.5 Angstrom
Class: hydrolase
Keywords: beta-Lactamase, antibiotic resistance, x-ray structure, TEM-34, HYDROLASE
Deposited on 2002-04-17, released 2002-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.177
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class A beta-Lactamase- TEM-34
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-260)
      • engineered (43)
    Domains in SCOPe 2.04: d1li9a_
  • Heterogens: PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1li9A (A:)
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmvstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw