PDB entry 1lh3

View 1lh3 on RCSB PDB site
Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1982-04-23, released 1983-01-20
The last revision prior to the SCOP 1.75 freeze date was dated 1983-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: leghemoglobin (cyano met)
  Species: Lupinus luteus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02240 (0-152)
    • conflict (78)
    • conflict (149)
  Domains in SCOP 1.75: d1lh3a_
• Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lh3A (A:)
  galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
  qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
  vvgakwseelnsawtiaydelaivikkemddaa