PDB entry 1lgd

View 1lgd on RCSB PDB site
Description: Crystal Structure Analysis of HCA II Mutant T199P in Complex with Bicarbonate
Class: lyase
Keywords: HCAII mutant T199P-BCT complex, LYASE
Deposited on 2002-04-15, released 2002-07-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered (197)
      • conflict (204)
    Domains in SCOPe 2.03: d1lgda_
  • Heterogens: ZN, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lgdA (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nnghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslptppllesvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgdA (A:)
    hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
    lpesldywtypgslptppllesvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk