PDB entry 1lfm

View 1lfm on RCSB PDB site
Description:
Deposited on 2002-04-11, released 2002-07-19
The last revision prior to the SCOP 1.65 freeze date was dated 2002-07-19, with a file datestamp of 2002-07-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lfma_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1lfmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lfmA (A:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lfmB (B:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats