PDB entry 1lfa

View 1lfa on RCSB PDB site
Description: cd11a I-domain with bound mn++
Class: cell adhesion
Keywords: cell adhesion
Deposited on 1995-09-08, released 1996-01-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd11a
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lfaa_
  • Chain 'B':
    Compound: cd11a
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lfab_
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lfaA (A:)
    cikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lfaA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lfaB (B:)
    cikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lfaB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi