PDB entry 1lel

View 1lel on RCSB PDB site
Description: the avidin bcap complex
Deposited on 2002-04-10, released 2002-11-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.204
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lela_
  • Chain 'B':
    Domains in SCOP 1.63: d1lelb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lelA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lelA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttakesplhgtentinkrtqptfgftvnw
    kfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lelB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lelB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttaeikesplhgtentinkrtqptfgftv
    nwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl