PDB entry 1ldp

View 1ldp on RCSB PDB site
Description: crystal structure of murine MHC class I h-2ld with a mixture of bound peptides
Class: complex (MHC I/peptide)
Keywords: complex (MHC I/peptide), major histocompatibility complex, immunology, cellular immunity, peptide antigen, cell surface receptor, antigen receptor, antigen presentation
Deposited on 1998-03-15, released 1998-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.221
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: MHC class I h-2ld
    Species: Mus musculus [TaxId:10090]
    Gene: H-2LD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ldph1, d1ldph2
  • Chain 'L':
    Compound: MHC class I h-2ld
    Species: Mus musculus [TaxId:10090]
    Gene: H-2LD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ldpl_
  • Chain 'P':
    Compound: peptide
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 1LDP (0-8)
  • Chain 'Q':
    Compound: peptide
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 1LDP (0-8)
  • Heterogens: NDG

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ldpH (H:)
gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwasvvvplgkeqnytcrvyheglpepltl

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ldpL (L:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.