PDB entry 1ldp

View 1ldp on RCSB PDB site
Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
Deposited on 1998-03-15, released 1998-06-17
The last revision prior to the SCOP 1.63 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.221
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldpH (H:)
    gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
    eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
    cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldpL (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm