PDB entry 1ldm

View 1ldm on RCSB PDB site
Description: Refined crystal structure of dogfish M4 apo-lactate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1987-11-25, released 1989-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m4 lactate dehydrogenase
    Species: Squalus acanthias [TaxId:7797]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00341 (0-328)
      • conflict (204-205)
      • conflict (207-209)
      • conflict (213-214)
      • conflict (307)
    Domains in SCOPe 2.06: d1ldma1, d1ldma2
  • Heterogens: NAD, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldmA (A:)
    atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
    emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
    ipnivkhspdciilvvsnpvdvltyvawklsglpmhriigsgcnldsarfrylmgerlgv
    hscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkdkqdwkklhkdvvdsayevik
    lkgytswaiglsvadlaetimknlcrvhpvstmvkdfygikdnvflslpcvlndhgisni
    vkmklkpneeqqlqksattlwdiqkdlkf