PDB entry 1ldj

View 1ldj on RCSB PDB site
Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
Deposited on 2002-04-08, released 2002-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-08, with a file datestamp of 2002-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.247
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldjA (A:)
    ldqiwddlragiqqvytrqsmaksrymelythvynyctsvhqsnqargagvppskskkgq
    tpggaqfvglelykrlkeflknyltnllkdgedlmdesvlkfytqqwedyrfsskvlngi
    caylnrhwvrrecdegrkgiyeiyslalvtwrdclfrplnkqvtnavlkliekerngeti
    ntrlisgvvqsyvelglneddafakgptltvykesfesqfladterfytresteflqqnp
    vteymkkaearlleeqrrvqvylhestqdelarkceqvliekhleifhtefqnlldadkn
    edlgrmynlvsriqdglgelkkllethihnqglaaiekcgeaalndpkmyvqtvldvhkk
    ynalvmsafnndagfvaaldkacgrfinnnavtkmaqssskspellarycdsllkksskn
    peeaeledtlnqvmvvfkyiedkdvfqkfyakmlakrlvhqnsasddaeasmisklkqac
    gfeytsklqrmfqdigvskdlneqfkkhltnsepldldfsiqvlssgswpfqqsctfalp
    selersyqrftafyasrhsgrkltwlyqlskgelvtncfknrytlqastfqmaillqynt
    edaytvqqltdstqikmdilaqvlqillkskllvledenanvdevelkpdtliklylgyk
    nkklrvninvpmkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevlt
    qlssrfkprvpvikkcidiliekeylervdgekdtysyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldjA (A:)
    ldqiwddlragiqqvytrqsmaksrymelythvynyctsvglelykrlkeflknyltnll
    kdgedlmdesvlkfytqqwedyrfsskvlngicaylnrhwvrrecyeiyslalvtwrdcl
    frplnkqvtnavlkliekerngetintrlisgvvqsyvelglneddafakgptltvykes
    fesqfladterfytresteflqqnpvteymkkaearlleeqrrvqvylhestqdelarkc
    eqvliekhleifhtefqnlldadknedlgrmynlvsriqdglgelkkllethihnqglaa
    iekcgeaalndpkmyvqtvldvhkkynalvmsafnndagfvaaldkacgrfinnnavtkm
    aqssskspellarycdsllkkssknpeeaeledtlnqvmvvfkyiedkdvfqkfyakmla
    krlvhqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsepl
    dldfsiqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgelv
    tncfknrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllvl
    edenanvdevelkpdtliklylgyknkklrvninvpmkteqkqeqetthknieedrklli
    qaaivrimkmrkvlkhqqllgevltqlssrfkprvpvikkcidiliekeylervdgekdt
    ysyla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ldjB (B:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
    fhfhcisrwlktrqvcpldnrewefqkygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldjB (B:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
    fhfhcisrwlktrqvcpldnrewefqky