PDB entry 1ldg

View 1ldg on RCSB PDB site
Description: plasmodium falciparum l-lactate dehydrogenase complexed with nadh and oxamate
Class: oxidoreductase
Keywords: oxidoreductase, tricarboxylic acid cycle, nad
Deposited on 1996-09-10, released 1997-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27743 (Start-315)
      • conflict (72)
      • conflict (95)
    Domains in SCOPe 2.06: d1ldga1, d1ldga2
  • Heterogens: NAI, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldgA (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagsdvvivtagftkapgksdkewnrldllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldgA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagsdvvivtagftkapgksdkewnrldllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkala