PDB entry 1ldb

View 1ldb on RCSB PDB site
Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
Class: oxidoreductase(choh(d)-nad(a))
Keywords: oxidoreductase(choh(d)-nad(a))
Deposited on 1989-03-27, released 1989-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.286
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apo-l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldba1, d1ldba2
  • Chain 'B':
    Compound: apo-l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldbb1, d1ldbb2
  • Chain 'C':
    Compound: apo-l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldbc1, d1ldbc2
  • Chain 'D':
    Compound: apo-l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldbd1, d1ldbd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldbA (A:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldbA (A:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpidlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayld
    glygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ldbB (B:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldbB (B:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpidlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayld
    glygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ldbC (C:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldbC (C:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpidlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayld
    glygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ldbD (D:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldbD (D:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpidlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayld
    glygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr