PDB entry 1ldb

View 1ldb on RCSB PDB site
Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
Deposited on 1989-03-27, released 1989-07-12
The last revision prior to the SCOP 1.55 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.286
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ldb_1, d1ldb_2
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'D':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ldb_ (-)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldb_ (-)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpidlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayld
    glygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.