PDB entry 1ld9

View 1ld9 on RCSB PDB site
Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide
Class: major histocompatibility complex
Keywords: major histocompatibility complex, ld
Deposited on 1997-04-24, released 1998-05-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I h-2ld heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ld9a1, d1ld9a2
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ld9b_
  • Chain 'C':
    Compound: nano-peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1LD9 (0-8)
  • Chain 'D':
    Compound: MHC class I h-2ld heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ld9d1, d1ld9d2
  • Chain 'E':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ld9e_
  • Chain 'F':
    Compound: nano-peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1LD9 (0-8)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9A (A:)
    gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
    eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
    cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9B (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9D (D:)
    gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
    eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
    cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9E (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'F':
    No sequence available.