PDB entry 1ld9

View 1ld9 on RCSB PDB site
Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide
Deposited on 1997-04-24, released 1998-05-06
The last revision prior to the SCOP 1.63 freeze date was dated 1998-05-06, with a file datestamp of 1998-05-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9A (A:)
    gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
    eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
    cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9B (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9D (D:)
    gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
    eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
    cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld9E (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm