PDB entry 1lcy

View 1lcy on RCSB PDB site
Description: Crystal Structure of the Mitochondrial Serine Protease HtrA2
Class: hydrolase
Keywords: apoptosis, serine protease, PDZ domain, caspase activation, IAP-binding, HYDROLASE
Deposited on 2002-04-07, released 2002-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HtrA2 serine protease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43464 (Start-324)
      • engineered (172)
    Domains in SCOPe 2.05: d1lcya1, d1lcya2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lcyA (A:)
    avpspppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadgli
    vtnahvvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrq
    gefvvamgspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnaggplvnl
    dgevigvntmkvtagisfaipsdrlreflhrgekknsssgisgsqrryigvmmltlspsi
    laelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaigeqmvqnaedvyeavrt
    qsqlavqirrgretltlyvtpevte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lcyA (A:)
    ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
    vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
    amgspfalqntitsgivssaqrpnveyiqtdaaidfgnaggplvnldgevigvntmkvta
    gisfaipsdrlreflhrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspa
    hraglrpgdvilaigeqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte