PDB entry 1lcj

View 1lcj on RCSB PDB site
Description: sh2 (src homology-2) domain of human p56-lck tyrosine kinase complexed with the 11 residue phosphotyrosyl peptide epqpyeeipiyl
Deposited on 1994-12-12, released 1995-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1lcja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lcjA (A:)
  epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
  irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt