PDB entry 1lby

View 1lby on RCSB PDB site
Description: Crystal Structure of a complex (P32 crystal form) of dual activity FBPase/IMPase (AF2372) from Archaeoglobus fulgidus with 3 Manganese ions, Fructose-6-Phosphate, and Phosphate ion
Class: hydrolase
Keywords: dual activity, FBPase, IMPase, archaeal phosphatase, product complex, HYDROLASE
Deposited on 2002-04-04, released 2002-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.154
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose 1,6-bisphosphatase/inositol monophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lbya_
  • Chain 'B':
    Compound: fructose 1,6-bisphosphatase/inositol monophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lbyb_
  • Heterogens: F6P, MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lbyA (A:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lbyB (B:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik