PDB entry 1lbx

View 1lbx on RCSB PDB site
Description: Crystal Structure of a ternary complex of dual activity FBPase/IMPase (AF2372) from Archaeoglobus fulgidus with Calcium ions and D-myo-Inositol-1-Phosphate
Class: hydrolase
Keywords: dual activity, FBPase, IMPase, archaeal phosphatase, ternary complex with metal and substrate, HYDROLASE
Deposited on 2002-04-04, released 2002-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose 1,6-bisphosphatase/inositol monophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lbxa_
  • Chain 'B':
    Compound: fructose 1,6-bisphosphatase/inositol monophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lbxb_
  • Heterogens: CA, IPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lbxA (A:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lbxB (B:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik