PDB entry 1lbv

View 1lbv on RCSB PDB site
Description: Crystal Structure of apo-form (P21) of dual activity FBPase/IMPase (AF2372) from Archaeoglobus fulgidus
Class: hydrolase
Keywords: dual activity, FBPase, IMPase, archaeal phosphatase, apo-form, HYDROLASE
Deposited on 2002-04-04, released 2002-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose 1,6-bisphosphatase/inositol monophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lbva_
  • Chain 'B':
    Compound: fructose 1,6-bisphosphatase/inositol monophosphatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF2372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lbvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lbvA (A:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lbvB (B:)
    mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
    rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
    atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
    dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
    eklhpkllelik