PDB entry 1lbi

View 1lbi on RCSB PDB site
Description: lac repressor
Class: transcription regulation
Keywords: transcription regulation, DNA-binding, repressor
Deposited on 1996-02-17, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lac repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOP 1.73: d1lbia_
  • Chain 'B':
    Compound: lac repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOP 1.73: d1lbib_
  • Chain 'C':
    Compound: lac repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOP 1.73: d1lbic_
  • Chain 'D':
    Compound: lac repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOP 1.73: d1lbid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lbiA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbiA (A:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lbiB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbiB (B:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lbiC (C:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbiC (C:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lbiD (D:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbiD (D:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle