PDB entry 1lbh

View 1lbh on RCSB PDB site
Description: intact lactose operon repressor with gratuitous inducer iptg
Class: transcription regulation
Keywords: transcription regulation, DNA-binding, repressor
Deposited on 1996-02-17, released 1996-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.23
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intact lactose operon repressor with gratuitous inducer iptg
    Species: Escherichia coli [TaxId:562]
    Gene: LAC I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOPe 2.06: d1lbha_
  • Chain 'B':
    Compound: intact lactose operon repressor with gratuitous inducer iptg
    Species: Escherichia coli [TaxId:562]
    Gene: LAC I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOPe 2.06: d1lbhb_
  • Chain 'C':
    Compound: intact lactose operon repressor with gratuitous inducer iptg
    Species: Escherichia coli [TaxId:562]
    Gene: LAC I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOPe 2.06: d1lbhc_
  • Chain 'D':
    Compound: intact lactose operon repressor with gratuitous inducer iptg
    Species: Escherichia coli [TaxId:562]
    Gene: LAC I
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • conflict (108)
      • conflict (285)
    Domains in SCOPe 2.06: d1lbhd_
  • Heterogens: IPT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lbhA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbhA (A:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lbhB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbhB (B:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lbhC (C:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbhC (C:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lbhD (D:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbhD (D:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle