PDB entry 1lbd

View 1lbd on RCSB PDB site
Description: ligand-binding domain of the human nuclear receptor rxr-alpha
Deposited on 1996-05-22, released 1996-11-08
Made obsolete by 6hn6 on 2019-02-20

The last revision prior to the SCOP 1.63 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1lbd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lbd_ (-)
    sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt