PDB entry 1lb3

View 1lb3 on RCSB PDB site
Description: Structure of recombinant mouse L chain ferritin at 1.2 A resolution
Class: metal binding protein
Keywords: iron storage
Deposited on 2002-04-02, released 2003-01-28
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.134
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain 1
    Species: MUS MUSCULUS
    Gene: FTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29391
      • engineered (120)
    Domains in SCOP 1.73: d1lb3a_
  • Heterogens: SO4, CD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lb3A (A:)
    tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
    gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
    adphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltlk
    hd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb3A (A:)
    sqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekreg
    aerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsara
    dphlcdfleshyldkevklikkmgnhltnlrrvaslgeylferltlk