PDB entry 1lb1

View 1lb1 on RCSB PDB site
Description: Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA
Class: signaling protein
Keywords: GUANINE NUCLEOTIDE EXCHANGE FACTOR, SMALL G-PROTEIN, RHOA, DBS, DH domain, PH domain, SIGNALING PROTEIN
Deposited on 2002-04-01, released 2002-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.236
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • see remark 999 (74-79)
    Domains in SCOPe 2.07: d1lb1a1, d1lb1a2
  • Chain 'B':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RhoA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lb1b_
  • Chain 'C':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • see remark 999 (74-79)
    Domains in SCOPe 2.07: d1lb1c1, d1lb1c2
  • Chain 'D':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RhoA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lb1d_
  • Chain 'E':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • see remark 999 (74-79)
    Domains in SCOPe 2.07: d1lb1e1, d1lb1e2
  • Chain 'F':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RhoA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lb1f_
  • Chain 'G':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • see remark 999 (74-79)
    Domains in SCOPe 2.07: d1lb1g1, d1lb1g2
  • Chain 'H':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RhoA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lb1h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lb1A (A:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1A (A:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkglarfkpmqrhlflheka
    vlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqap
    tpeikaawvneirkvltsqlqacr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lb1B (B:)
    gamaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalw
    dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
    kdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraa
    lqarrgkkksgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1B (B:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lb1C (C:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1C (C:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkglarfkpmqrhlflheka
    vlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqap
    tpeikaawvneirkvltsqlqacr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lb1D (D:)
    gamaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalw
    dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
    kdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraa
    lqarrgkkksgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1D (D:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lb1E (E:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1E (E:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkglarfkpmqrhlflheka
    vlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqap
    tpeikaawvneirkvltsqlqacr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lb1F (F:)
    gamaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalw
    dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
    kdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraa
    lqarrgkkksgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1F (F:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lb1G (G:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1G (G:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkglarfkpmqrhlflheka
    vlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqap
    tpeikaawvneirkvltsqlqacr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1lb1H (H:)
    gamaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalw
    dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
    kdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraa
    lqarrgkkksgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lb1H (H:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq