PDB entry 1la1

View 1la1 on RCSB PDB site
Description: gro-el fragment (apical domain) comprising residues 188-379
Deposited on 2002-03-27, released 2002-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1la1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1la1A (A:)
    dvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpl
    liiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigm
    elekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqe
    rvaklaggvavi