PDB entry 1la1

View 1la1 on RCSB PDB site
Description: Gro-EL Fragment (Apical Domain) Comprising Residues 188-379
Class: chaperone
Keywords: molecular chaperone, protein folding, chaperone
Deposited on 2002-03-27, released 2002-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1la1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1la1A (A:)
    dvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpl
    liiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigm
    elekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklqe
    rvaklaggvavi