PDB entry 1l9q

View 1l9q on RCSB PDB site
Description: crystal structure of the i257l variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Class: oxidoreductase
Keywords: cupredoxin fold, OXIDOREDUCTASE
Deposited on 2002-03-26, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.156
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-End)
      • engineered (253)
    Domains in SCOPe 2.07: d1l9qa1, d1l9qa2
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-End)
      • engineered (253)
    Domains in SCOPe 2.07: d1l9qb1, d1l9qb2
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-End)
      • engineered (253)
    Domains in SCOPe 2.07: d1l9qc1, d1l9qc2
  • Heterogens: CU, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l9qA (A:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphllgghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgtiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9qA (A:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphllgghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l9qB (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphllgghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgtiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9qB (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphllgghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l9qC (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphllgghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgtiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9qC (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphllgghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg