PDB entry 1l9n

View 1l9n on RCSB PDB site
Description: Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation
Deposited on 2002-03-26, released 2002-05-29
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-29, with a file datestamp of 2002-05-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l9nA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9nA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpsiigklkvagmlavgkevn
    lvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpikisyaqy
    erylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvqmlfsnp
    ldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqlladfscnkf
    paikamlsidvae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l9nB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9nB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpsiigklkvagmlavgkevn
    lvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpikisyaqy
    erylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvqmlfsnp
    ldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqlladfscnkf
    paikamlsidvae